Langues24.com
Langues24
Domain Summary
What is the traffic rank for Langues24.com?
• Langues24.com ranks #3,042,826 globally on HypeStat.
What percent of global Internet users visit Langues24.com?
• 2.3E-5% of global Internet users visit Langues24.com
How many people visit Langues24.com each day?
• Langues24.com receives approximately 1.1K visitors and 1,546 page impressions per day.
How much Langues24.com can earn?
• Langues24.com should earn about $6.31/day from advertising revenue.
What is Langues24.com estimated value?
• Estimated value of Langues24.com is $5,577.43.
What IP addresses does Langues24.com resolve to?
• Langues24.com resolves to the IP addresses 216.239.38.21.
Where are Langues24.com servers located in?
• Langues24.com has servers located in California, United States.
langues24.com Profile
Title:
Langues24
Description:Langues24 : Apprendre les langues gratuitement 24/24
Tags:
Category:Science and Education / Education
What technologies does langues24.com use?
These are the technologies used at langues24.com. langues24.com has a total of 10 technologies installed in 8 different categories.langues24.com Traffic Analysis
Langues24.com is ranked #3,042,826 in the world. This website is viewed by an estimated 1.1K visitors daily, generating a total of 1.5K pageviews. This equates to about 34.4K monthly visitors. Langues24.com traffic has increased by 28.8% compared to last month.Daily Visitors1.1K
66.79%
Monthly Visits34.4K
28.8%
Pages per Visit1.36
34.69%
Visit duration01:35
100%
Bounce Rate38.17%
113.32%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 1,134
- Monthly Visits:
- 34,360
- Pages per Visit:
- 1.36
- Daily Pageviews:
- 1,546
- Avg. visit duration:
- 01:35
- Bounce rate:
- 38.17%
- Global Reach:
- 2.3E-5%
- Monthly Visits (SEMrush):
- 4,615
- Monthly Unique Visitors (SEMrush):
- 4,615
- Monthly Visits (SimilarWeb):
- 34,726
- HypeRank:
- 3,042,826
- SEMrush Rank:
- 21,410,575
- SimilarWeb Rank:
- 1,766,507
Traffic sources
- Direct:
- 0%
- Referral:
- 72.52%
- Search:
- 27.48%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 21.08%
- Mobile:
- 78.92%
Total Visits Last 3 Months
73.5K
MAY
26.7K
JUN
34.4K
JUL
Backlinks Report ▼
Langues24.com has a total of 206 backlinks from 93 referring domains and most of them comes from Singapore.- Total Backlinks:
- 206
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 93
- Referring IPs:
- 13
- Authority Domain Score:
- 11
Backlinks by country
- Country
- Domains
- Singapore 48
- United States 41
Backlinks by TLDs
- TLD Distribution
- Domains
- .in
- 30
- .pw
- 30
- .com
- 16
- .edu
- 0
- .gov
- 0
Which sites are competitors to langues24.com?
Websites similar to langues24.com are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- ismac.ac.ma
- Compare >257
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 594 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with langues24.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 218
- Bing Index:
- 727
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- langues24.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 21,410,575
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 5
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $6.3 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $189.3 and annual gross revenue of approximately $2.3K. Based on these figures, the site's net worth is estimated at around $5.6K.How much would langues24.com make?
- Daily Revenue:
- $6.31
- Monthly Revenue:
- $189.30
- Yearly Revenue:
- $2,303.15
How much is langues24.com worth?
- Website Value:
- $5.6K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- langues24.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- langues24.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- langues24.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is langues24.com hosted? ▼
Langues24.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 216.239.38.21
- ASN:
- AS15169
- ISP:
- Google LLC
- Server Location:
- California, CA
United States, US
Other sites hosted on 216.239.38.21
How fast does langues24.com load? ▼
The average loading time of langues24.com is 239 ms. The Desktop speed index is 91 and mobile speed index is 0.- Average Load Time:
- 239 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a AVERAGE speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)12ms
Time To First Byte (TTFB)893ms
First Contentful Paint (FCP)2.0s
First Input Delay (FID)4ms
Interaction To Next Paint (INP)116ms
Largest Contentful Paint (LCP)3.1s
Origin Data
All pages served from this origin have an AVERAGE speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)12ms
Time To First Byte (TTFB)893ms
First Contentful Paint (FCP)2.0s
First Input Delay (FID)4ms
Interaction To Next Paint (INP)116ms
Largest Contentful Paint (LCP)3.1s
Lab Data
Timing budget
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Total Blocking Time 40 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
First Contentful Paint 1.0 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Meaningful Paint 1.1 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Largest Contentful Paint 1.3 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Max Potential First Input Delay 100 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Has a `<meta name="viewport">` tag with `width` or `initial-scale`
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Speed Index 1.4 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Time to Interactive 2.6 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Preload Largest Contentful Paint image
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Performance budget
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Does langues24.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on langues24.com are reduced by 83%.
langues24.com use gzip compression.
Original size: 208.18 KB
Compressed size: 35.12 KB
File reduced by: 173.06 KB (83%)
Compressed size: 35.12 KB
File reduced by: 173.06 KB (83%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. langues24.com supports HTTPS. langues24.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.langues24.com
Organization:
Location:
Issuer: GTS CA 1D4
Valid from: Jun 30 16:38:04 2023 GMT
Valid until: Sep 28 17:19:31 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: GTS CA 1D4
Valid from: Jun 30 16:38:04 2023 GMT
Valid until: Sep 28 17:19:31 2023 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GTS CA 1D4
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GTS Root R1
Valid from: Aug 13 00:00:42 2020 GMT
Valid until: Sep 30 00:00:42 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: GTS Root R1
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Jun 19 00:00:42 2020 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. langues24.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.location: https://www.langues24.com/
date: Sun, 27 Aug 2023 03:15:02 GMT
content-type: text/html; charset=UTF-8
server: ghs
content-length: 223
x-xss-protection: 0
x-frame-options: SAMEORIGIN
HTTP/2 200
x-robots-tag: all
content-type: text/html; charset=UTF-8
expires: Sun, 27 Aug 2023 03:15:02 GMT
date: Sun, 27 Aug 2023 03:15:02 GMT
cache-control: private, max-age=0
last-modified: Sat, 26 Aug 2023 23:53:53 GMT
etag: W/"e078e42d5a6a557ec71cf0fcb4c7278bc1fd888313114b6acadaf803e4e2681e"
content-encoding: gzip
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
content-length: 35962
server: GSE
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
HINFO | 3600 | ||
A | 216.239.38.21 | 1693 | |
A | 216.239.32.21 | 1693 | |
A | 162.255.119.99 | 1693 | |
A | 216.239.36.21 | 1693 | |
A | 216.239.34.21 | 1693 | |
NS | 3494 | ||
NS | 3494 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 30, 2020 and will expire on June 30, 2025 if not renewed. This website is now assigned through the registrar NameCheap, Inc.. The WHOIS data for this website's domain was last updated on April 26, 2023.- Domain Created:
- 2020-06-30
- Domain Expires:
- 2025-06-30
- Domain Updated:
- 2023-04-26
- Domain Age:
- 4 years 9 months 12 days
- Domain Registrar:
- NameCheap, Inc.
- WhoIs:
Domain name: langues24.com Registry Domain ID: 2542739916_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2023-04-26T13:47:48.16Z Creation Date: 2020-06-30T09:38:49.00Z Registrar Registration Expiration Date: 2025-06-30T09:38:49.00Z Registrar: NAMECHEAP INC Registrar IANA ID: 1068 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.9854014545 Reseller: NAMECHEAP INC Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Redacted for Privacy Registrant Organization: Privacy service provided by Withheld for Privacy ehf Registrant Street: Kalkofnsvegur 2 Registrant City: Reykjavik Registrant State/Province: Capital Region Registrant Postal Code: 101 Registrant Country: IS Registrant Phone: +354.4212434 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email:
Registry Admin ID: Admin Name: Redacted for Privacy Admin Organization: Privacy service provided by Withheld for Privacy ehf Admin Street: Kalkofnsvegur 2 Admin City: Reykjavik Admin State/Province: Capital Region Admin Postal Code: 101 Admin Country: IS Admin Phone: +354.4212434 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email:
Registry Tech ID: Tech Name: Redacted for Privacy Tech Organization: Privacy service provided by Withheld for Privacy ehf Tech Street: Kalkofnsvegur 2 Tech City: Reykjavik Tech State/Province: Capital Region Tech Postal Code: 101 Tech Country: IS Tech Phone: +354.4212434 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email:
Name Server: dns1.registrar-servers.com Name Server: dns2.registrar-servers.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-08-26T21:16:27.15Z